Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
 

 

TTD Target ID: TTDS00237

Target Information
NameDihydropteroate synthetase    
Type of targetSuccessful target    
SynonymsDHPS    
Dihydropteroate pyrophosphorylase    
Dihydropteroate synthase    
H2Pte synthase    
DiseaseBacterial infections    [1]
Malaria    [2][3][4]
Drug(s)DapsoneApprovedPneumocystis carinii pneumonia [5]
SulfacytineApprovedUrinary tract infections[6]
SulfadiazineApprovedUrinary tract infections [7]
SulfadoxineApprovedMalaria[8]
SulfamerazineApprovedBacterial infections[9]
SulfamethazineApprovedBacterial infections[10]
SulfamethizoleApprovedUrinary tract infections[11]
SulfamethoxazoleApprovedBacterial infections[12]
SulfametopyrazineApprovedUrinary tract infection[13]
SulfapyridineApprovedDermatitis herpetiformis[9]
SulfisoxazoleApprovedUrinary tract infections[14]
SulfonamidesApprovedBacterial infections[15]
SulphadoxineApprovedMalaria[16]
EC NumberEC 2.5.1.15
UniProt IDP26282
Q8IAU3
Q93RQ9
Q96W63
Q9BIX9
PDB Structure1AJ0; 1AJ2; 1AJZ.    
FunctionDhps catalyzes the formation of the immediate precursor of folic acid. It is implicated in resistance to sulfonamide.    
SequenceMKLFAQGTSLDLSHPHVMGILNVTPDSFSDGGTHNSLIDAVKHANLMINAGATIIDVGGE STRPGAAEVSVEEELQRVIPVVEAIAQRFEVWISVDTSKPEVIRESAKVGAHIINDIRSL SEPGALEAAAETGLPVCLMHMQGNPKTMQEAPKYDDVFAEVNRYFIEQIARCEQAGIAKE KLLLDPGFGFGKNLSHNYSLLARLAEFHHFNLPLLVGMSRKSMIGQLLNVGPSERLSGSL ACAVIAAMQGAHIIRVHDVKETVEAMRVVEATLSAKENKRYE
Target ValidationClick to Find Target Validation Information.    
Inhibitor2,6-diamino-5-nitropyrimidin-4 (3H)-one[17]
2,6-diamino-5-nitrosopyrimidin-4 (3H)-one[17]
2-amino-8-methyl-7,8-dihydropteridin-4 (3H)-one[17]
6-Methylamino-5-Nitroisocytosine[18]
Dapsone[5]
Pterin-6-Yl-Methyl-Monophosphate[19]
Pteroic Acid[20]
Sulfacytine[6]
Sulfadiazine[7]
Sulfadoxine[8]
Sulfamerazine[9]
Sulfamethazine[10]
Sulfamethizole[11]
Sulfamethoxazole[12]
Sulfametopyrazine[13]
Sulfapyridine[9]
Sulfisoxazole[14]
[Pterin-6-Yl Methanyl]-Phosphonophosphate[19]
BinderSulfonamide[1]
Sulfonamides[15]
Sulphadoxine[16]
Sulphameth oxazole[21]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Resistance to trimethoprim and sulfonamides. Vet Res. 2001 May-Aug;32(3-4):261-73. To Reference
Ref 2Utilization of exogenous folate in the human malaria parasite Plasmodium falciparum and its critical role in antifolate drug synergy. Mol Microbiol. 1999 Jun;32(6):1254-62. To Reference
Ref 3In vivo selection for a specific genotype of dihydropteroate synthetase of Plasmodium falciparum by pyrimethamine-sulfadoxine but not chlorproguanil-dapsone treatment. J Infect Dis. 1998 May;177(5):1429-33. To Reference
Ref 4Sequence variation of the hydroxymethyldihydropterin pyrophosphokinase: dihydropteroate synthase gene in lines of the human malaria parasite, Plasmodium falciparum, with differing resistance to sulfadoxine. Eur J Biochem. 1994 Sep 1;224(2):397-405. To Reference
Ref 5Biochemical and structural characterization of the putative dihydropteroate synthase ortholog Rv1207 of Mycobacterium tuberculosis. FEMS Microbiol Lett. 2008 Oct;287(1):128-35. Epub 2008 Aug 1. To Reference
Ref 6Sulfacytine in uncomplicated urinary tract infections. Double-blind comparison with sulfisoxazole. Urology. 1976 Mar;7(3):267-71. To Reference
Ref 7Sulfadiazine/hydroxypropyl-beta-cyclodextrin host-guest system: Characterization, phase-solubility and molecular modeling. Bioorg Med Chem. 2008 May 15;16(10):5788-94. Epub 2008 Mar 27. To Reference
Ref 8Geographical distribution of amino acid mutations in Plasmodium vivax DHFR and DHPS from malaria endemic areas of Thailand. Am J Trop Med Hyg. 2008 Mar;78(3):462-7. To Reference
Ref 9A confirmatory method for the simultaneous extraction, separation, identification and quantification of Tetracycline, Sulphonamide, Trimethoprim and Dapsone residues in muscle by ultra-high-performance liquid chromatography-tandem mass spectrometry according to Commission Decision 2002/657/EC. J Chromatogr A. 2009 Jun 9. [Epub ahead of print] To Reference
Ref 10A new and simple method to determine trace levels of sulfonamides in honey by high performance liquid chromatography with fluorescence detection. J Chromatogr A. 2009 May 29. [Epub ahead of print] To Reference
Ref 11Inhibition of bioluminescence in Photobacterium phosphoreum by sulfamethizole and its stimulation by thymine. Biochim Biophys Acta. 1990 Jun 26;1017(3):229-34. To Reference
Ref 12In vitro activities of novel antifolate drug combinations against Plasmodium falciparum and human granulocyte CFUs. Antimicrob Agents Chemother. 1995 Apr;39(4):948-52. To Reference
Ref 13Plasmodium falciparum dihydrofolate reductase Val-16 and Thr-108 mutation associated with in vivo resistance to antifolate drug: a case study. Indian J Malariol. 2001 Sep-Dec;38(3-4):76-83. To Reference
Ref 14Antimicrob Agents Chemother. 1995 Aug;39(8):1756-63.Inhibition of recombinant Pneumocystis carinii dihydropteroate synthetase by sulfa drugs. To Reference
Ref 15Has nature already identified all useful antibacterial targets? Curr Opin Microbiol. 2008 Oct;11(5):387-92. Epub 2008 Oct 6. To Reference
Ref 16The fight against drug-resistant malaria: novel plasmodial targets and antimalarial drugs. Curr Med Chem. 2008;15(2):161-71. To Reference
Ref 17J Med Chem. 2010 Jan 14;53(1):166-77.Structural studies of pterin-based inhibitors of dihydropteroate synthase. To Reference
Ref 18Nucleic Acids Res. 2011 January; 39(Database issue): D1035¨CD1041. DrugBank 3.0: a comprehensive resource for ¡®Omics¡¯ research on drugs To Reference
Ref 19Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 20Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. To Reference
Ref 21Opportunities and challenges in antiparasitic drug discovery. Nat Rev Drug Discov. 2005 Sep;4(9):727-40. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

 
   
           
 
Computer-aided Drug Design
About BIDD | Databases | Software | Teaching | Research |  Links

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543