Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
 

 

TTD Target ID: TTDS00251

Target Information
NameVitamin D receptor    
Type of targetSuccessful target    
Synonyms1,25-dihydroxyvitamin D3 receptor    
Nuclear vitamin D receptor    
VDR    
Vitamin D(3) receptor    
Vitamin D3 receptor    
DiseaseBreast cancer    [1]
Colorectal cancer    [2]
Kaposi's sarcoma    [3]
Prostate cancer    [1]
Vitamin D deficiency    [4]
Drug(s)CalcidiolApprovedVitamin D deficiency[5][6]
CalcipotriolApprovedPsoriasis[7]
CalcitriolApprovedVitamin D deficiency[8]
CholecalciferolApprovedVitamin D deficiency[9][10][6]
DihydrotachysterolApprovedHypocalcemia and hypoparathyroidism[11][6]
ErgocalciferolApprovedHypoparathyroidism[5][6]
ParicalcitolApprovedHyperparathyroidism[12]
DoxercalciferolPhase IVChronic Kidney Disease; Kidney Transplantation[13]
BioChemical ClassZinc-finger    
UniProt IDP11473
PDB Structure1DB1; 1IE8; 1IE9; 1KB2; 1KB4; 1KB6; 1S0Z; 1S19.    
FunctionNuclear hormone receptor. Vdr mediates the action of vitamin d3 by controlling the expression of hormone sensitive genes.    
SequenceMEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTC PFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSL RPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSG DSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDPSVTLELSQLSMLPHLADLVSYSIQK VIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDV TKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLS NTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLE VFGNEIS
Target ValidationClick to Find Target Validation Information.    
QSAR ModelClick to Find Target QSAR Model.    
Inhibitor19-nor-14-epi-23-yne-1,25 dihydroxyvitamin D3[14]
KSP-BCS-1-alpha-CHF2-1624F2-2[15]
KSP-BCS-1-alpha-CHF2-20-epi-22-oxabishomo-26-OH[15]
Seocalcitol[16]
Agonist1alpha,25 dihydroxyvitamin D (3)[3]
Paricalcitol[12]
AntagonistCalcidiol[5][6]
Calcipotriol[7]
Calcitriol[8]
Dihydrotachysterol[11][6]
Doxercalciferol[13]
Ergocalciferol[5][6]
BinderCholecalciferol[9][10][6]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Antiproliferative signalling by 1,25(OH)2D3 in prostate and breast cancer is suppressed by a mechanism involving histone deacetylation. Recent Results Cancer Res. 2003;164:83-98. To Reference
Ref 2Vitamin D receptor expression in colorectal cancer. J Clin Pathol. 1999 Mar;52(3):181-3. To Reference
Ref 3Kaposi sarcoma is a therapeutic target for vitamin D(3) receptor agonist. Blood. 2000 Nov 1;96(9):3188-94. To Reference
Ref 4Mechanisms for the selective actions of vitamin D analogues. Curr Pharm Des. 2000 May;6(7):701-16. To Reference
Ref 5Vitamin D in health and disease. Clin J Am Soc Nephrol. 2008 Sep;3(5):1535-41. Epub 2008 Jun 4. To Reference
Ref 6Overview of general physiologic features and functions of vitamin D. Am J Clin Nutr. 2004 Dec;80(6 Suppl):1689S-96S. To Reference
Ref 7Cellular and molecular mechanisms involved in the action of vitamin D analogs targeting vitiligo depigmentation. Curr Drug Targets. 2008 Apr;9(4):345-59. To Reference
Ref 8The Physiology of Vitamin D Receptor Activation. Contrib Nephrol. 2009;163:206-212. Epub 2009 Jun 3. To Reference
Ref 9Vitamin D2 or vitamin D3?. Rev Med Interne. 2008 Oct;29(10):815-20. Epub 2008 Apr 11. To Reference
Ref 10Genetic polymorphisms in vitamin D receptor, vitamin D-binding protein, Toll-like receptor 2, nitric oxide synthase 2, and interferon-gamma genes and its association with susceptibility to tuberculosis. Braz J Med Biol Res. 2009 Apr;42(4):312-22. To Reference
Ref 11In vivo metabolism of the vitamin D analog, dihydrotachysterol. Evidence for formation of 1 alpha,25- and 1 beta,25-dihydroxy-dihydrotachysterol metabolites and studies of their biological activity. J Biol Chem. 1993 Jan 5;268(1):282-92. To Reference
Ref 12New Acquisitions in Therapy of Secondary Hyperparathyroidism in Chronic Kidney Disease and Peritoneal Dialysis Patients: Role of Vitamin D Receptor Activators. Contrib Nephrol. 2009;163:219-226. Epub 2009 Jun 3. To Reference
Ref 13Emerging drugs for psoriasis. Expert Opin Emerg Drugs. 2009 Mar;14(1):145-63. To Reference
Ref 14Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. To Reference
Ref 15J Med Chem. 2006 Dec 14;49(25):7513-7.Low-calcemic, highly antiproliferative, 1-difluoromethyl hybrid analogs of the natural hormone 1alpha,25-dihydroxyvitamin D3: design, synthesis, and preliminary biological evaluation. To Reference
Ref 16Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

 
   
           
 
Computer-aided Drug Design
About BIDD | Databases | Software | Teaching | Research |  Links

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543