Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
 

 

TTD Target ID: TTDS00258

Target Information
NameParathyroid hormone/parathyroid hormone-related peptide receptor    
Type of targetSuccessful target    
SynonymsPTH/PTHr receptor    
PTH/PTHrP type I receptor    
Parathyroid hormone-related peptide (PTHRP)    
DiseaseCancer-associated morbidity    [1]
Malignancy-associated hypercalcemia    [2]
Drug(s)TeriparatideApprovedOsteogenesis imperfecta[3][4][5]
BioChemical ClassG-protein coupled receptor (Secretin family)    
PathwayNeuroactive ligand-receptor interaction
UniProt IDQ03431
PDB Structure1BL1; 1ET2; 1ET3; 3C4M.    
FunctionThis is a receptor for parathyroid hormone and for parathyroid hormone-related peptide. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase and also a phosphatidylinositol-calcium second messenger system.    
SequenceMGTARIAPGLALLLCCPVLSSAYALVDADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPA SIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPL GAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETRE REVFDRLGMIYTVGYSVSLASLTVAVLILAYFRRLHCTRNYIHMHLFLSFMLRAVSIFVK DAVLYSGATLDEAERLTEEELRAIAQAPPPPATAAAGYAGCRVAVTFFLYFLATNYYWIL VEGLYLHSLIFMAFFSEKKYLWGFTVFGWGLPAVFVAVWVSVRATLANTGCWDLSSGNKK WIIQVPILASIVLNFILFINIVRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVH YIVFMATPYTEVSGTLWQVQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIKKSWSRWTLA LDFKRKARSGSSSYSYGPMVSHTSVTNVGPRVGLGLPLSPRLLPTATTNGHPQLPGHAKP GTPALETLETTPPAMAAPKDDGFLNGSCSGLDEEASGPERPPALLQEEWETVM
Target ValidationClick to Find Target Validation Information.    
BinderTeriparatide[3][4][5]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Parathyroid hormone-related protein as a potential target of therapy for cancer-associated morbidity. Cancer. 2000 Jun 15;88(12 Suppl):2909-11. To Reference
Ref 2Parathyroid hormone-related peptide. Clin Invest Med. 1993 Oct;16(5):395-406. To Reference
Ref 3Parathyroid hormone, its fragments and their analogs for the treatment of osteoporosis. Treat Endocrinol. 2002;1(3):175-90. To Reference
Ref 4The N-terminal fragment of human parathyroid hormone receptor 1 constitutes a hormone binding domain and reveals a distinct disulfide pattern. Biochemistry. 2000 Aug 1;39(30):8878-87. To Reference
Ref 5A constitutively active mutant PTH-PTHrP receptor in Jansen-type metaphyseal chondrodysplasia. Science. 1995 Apr 7;268(5207):98-100. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

 
   
           
 
Computer-aided Drug Design
About BIDD | Databases | Software | Teaching | Research |  Links

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543