Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
 

 

TTD Target ID: TTDS00268

Target Information
NameB-lymphocyte antigen CD20    
Type of targetSuccessful target    
SynonymsB-lymphocyte surface antigen B1    
Bp35    
CD20    
Leu-16    
DiseaseB-cell lymphoma    [1]
Cancer, unspecific    [2]
Drug(s)IbritumomabApprovedNon-Hodgkins lymphoma[3]
OfatumumabApprovedChronic lymphocytic leukaemia[4][5]
RituximabApprovedNon-Hodgkins lymphoma[6][7]
TositumomabApprovedNon-Hodgkins lymphoma[3]
GA101Phase IIINon-Hodgkin's Lymphoma[8][9]
OcrelizumabPhase IIIMultiple Sclerosis, Primary Progressive[10][11]
OfatumumabPhase IIIDiffuse large B cell lymphoma and multiple sclerosis[4][5]
R7159Phase IIINon-Hodgkin's lymphoma[11][12]
Rituxan Hemotalogy/oncologyPhase IIIFollicular non-Hodgkin's lymphoma[8]
Rituxan ImmunologyPhase IIIPemphigus Disease[8]
Bevacizumab+RituximabPhase IILymphoma, Follicular, Non-Hodgkin's lymphoma[11]
GA101Phase IINon-Hodgkin's Lymphoma[8][9]
OcrelizumabPhase IIMultiple Sclerosis[10][11]
OfatumumabPhase IIRheumatoid arthritis and follicular lymphoma[4][5]
Iboctadekin & rituximabPhase INon-Hodgkin's lymphoma; Follicular lymphoma[5]
RituximabPhase IHematologic malignancies[13][11][14]
BioChemical ClassTransmembrane protein    
PathwayHematopoietic cell lineage
UniProt IDP11836
PDB Structure1S8B; 2OSL; 3BKY.    
FunctionThis protein may be involved in the regulation of b-cell activation and proliferation.    
SequenceMTTPRNSVNGTFPAEPMKGPIAMQSGPKPLFRRMSSLVGPTQSFFMRESKTLGAVQIMNG LFHIALGGLLMIPAGIYAPICVTVWYPLWGGIMYIISGSLLAATEKNSRKCLVKGKMIMN SLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPST QYCYSIQSLFLGILSVMLIFAFFQELVIAGIVENEWKRTCSRPKSNIVLLSAEEKKEQTI EIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP
Target ValidationClick to Find Target Validation Information.    
AntibodyBevacizumab+Rituximab[11]
GA101[8][9]
Iboctadekin & rituximab[5]
Ibritumomab[3]
Iodine-131-tositumomab[15][2]
Ocrelizumab[10][11]
Ofatumumab[4][5]
R7159[11][12]
Rituxan Hemotalogy/oncology[8]
Rituxan Immunology[8]
Rituximab[6][7]
Rituximab[13][11][14]
Tositumomab[3]
MultitargetBevacizumab+Rituximab[11]
Iboctadekin & rituximab[5]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Vaccination with CD20 peptides induces a biologically active, specific immune response in mice. Blood. 2002 May 15;99(10):3748-55. To Reference
Ref 2A phase I/II trial of iodine-131-tositumomab (anti-CD20), etoposide, cyclophosphamide, and autologous stem cell transplantation for relapsed B-cell lymphomas. Blood. 2000 Nov 1;96(9):2934-42. To Reference
Ref 3Structure of the Fab fragment of therapeutic antibody Ofatumumab provides insights into the recognition mechanism with CD20. Mol Immunol. 2009 Jul;46(11-12):2419-23. Epub 2009 May 8. To Reference
Ref 4Hughes B: 2009 FDA drug approvals. Nat Rev Drug Discov. 2010 Feb;9(2):89-92. To Reference
Ref 5GSK. Product Development Pipeline. February 2009. To Reference
Ref 6Contribution of radioimmunotherapy to the treatment of lymphoma. Ann Pharm Fr. 2008 Nov-Dec;66(5-6):300-8. Epub 2008 Nov 8. To Reference
Ref 7Nat Rev Drug Discov. 2003 Jan;2(1):38-51.Knockouts model the 100 best-selling drugs--will they model the next 100? To Reference
Ref 8Genentech. Product Development Pipeline. July 2009. To Reference
Ref 9Genetech. News for Genetech. June 2009. To Reference
Ref 10Emerging drugs for rheumatoid arthritis. Expert Opin Emerg Drugs. 2008 Mar;13(1):175-96. To Reference
Ref 11Roche. Product Development Pipeline. July 29 2009. To Reference
Ref 12National Cancer Institute. NCI Drug Dictionary. 2009 To Reference
Ref 13Emerging drugs for idiopathic thrombocytopenic purpura in adults. Expert Opin Emerg Drugs. 2008 Jun;13(2):237-54. To Reference
Ref 14Roche. Report of Roche. June 2006. To Reference
Ref 15Rituximab blocks binding of radiolabeled anti-CD20 antibodies (Ab) but not radiolabeled anti-CD45 Ab. Blood. 2008 Aug 1;112(3):830-5. Epub 2008 May 23. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

 
   
           
 
Computer-aided Drug Design
About BIDD | Databases | Software | Teaching | Research |  Links

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543