Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
 

 

TTD Target ID: TTDS00306

Target Information
NameCarbonic anhydrase II    
Type of targetSuccessful target    
SynonymsCA-II    
Carbonate dehydratase II    
Carbonic anhydrase C    
DiseaseGlaucoma    [1]
Pancreatic cancer    [2]
Renal failure    [3]
Drug(s)BenzthiazideApprovedHigh blood pressure[4][5]
ChlorothiazideApprovedEdema associated with congestive heart failure[6]
CyclothiazideApprovedEdema associated with congestive heart failure[7]
DorzolamideApprovedOpen-angle glaucoma[8]
EthinamateApprovedInsomnia[9]
BioChemical ClassCarbon-oxygen lyases    
EC NumberEC 4.2.1.1
PathwayNitrogen metabolism
UniProt IDP00918
PDB Structure12CA; 1A42; 1AM6; 1AVN; 1BCD; 1BIC; 1BN1; 1BN3.    
FunctionReversible hydration of carbon dioxide.    
SequenceMSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRIL NNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHL VHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDP RGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELM VDNWRPAQPLKNRQIKASFK
Target ValidationClick to Find Target Validation Information.    
QSAR ModelClick to Find Target QSAR Model.    
Inhibitor1,2,4-Triazole[10]
2,6-di-t-butylphenol[11]
4-CYANOPHENOL[12]
4-Methylimidazole[13]
ACETYLSULFANILAMIDE[14]
AL4623[10]
AL5300[10]
AL5424[10]
AL5927[10]
AL6528[10]
AL7099A[13]
AL7182[10]
Acetate Ion[10]
Al7089a[10]
Aminobenzolamide derivative[15]
Azide[16]
BENZOLAMIDE[17]
BUTYLATEDHYDROXYTOLUENE[11]
Benzthiazide[4][5]
Beta-Mercaptoethanol[10]
CATECHIN[18]
CATECHOL[19]
CGS-27023A[20]
CHLORIDE[16]
COUMARIN[21]
COUMATE[22]
CURCUMIN[18]
Chlorothiazide[6]
Cyanamide[10]
Cyclothiazide[7]
Dansylamide[10]
Ditiocarb sodium[23]
Dorzolamide[8]
ELLAGIC ACID[19]
EMATE[24]
EMATE[25]
Ethinamate[9]
FERULIC ACID[19]
Formic Acid[10]
GALLICACID[19]
GUAIACOL[11]
HYDROSULFIDE[16]
INDISULAM[26]
IODIDE[16]
Indan-5-sulfonic acid amide[27]
MAFENIDE[28]
Mercuribenzoic Acid[10]
Methyl Mercury Ion[10]
Methyl-phosphonic acid[29]
N-hydroxysulfamide[30]
N-hydroxysulfonamides[31]
NITRATE[16]
NSC-654077[32]
P-TOLUENESULFONAMIDE[17]
PARABEN[19]
PARAOXON[33]
PHENOL[18]
PHENYLDIFLUOROMETHANESULFONAMIDE[34]
PHENYLMETHANESULFONAMIDE[34]
PHENYLSULFAMATE[35]
PHENYLSULFAMIDE[35]
PRONTOCIL[36]
Phenyl Boronic acid[16]
Phenyl-phosphonic acid[29]
RESORCINOL[12]
SACCHARIN[37]
SALICYLATE[12]
SODIUM PERFLUOROHEXANESULFONAMIDE[38]
SPARFOSIC ACID[29]
SULFAMATE[16]
SULFAMIDE[16]
SULTHIAME[39]
Sulfenamido-sulfonamides[40]
Syringic Acid[19]
Thioureido sulfonamide[41]
beta-naphthylboronic acid[42]
biphenylboronic acid[42]
decyl sulfamate[43]
di (2,6-di-t-butylphenol)[11]
di (2,6-diisopropylphenol)[11]
di (2,6-dimethylphenol)[11]
indane-5-sulfonamide[39]
octane-1,8-diyl disulfamate[43]
octyl sulfamate[43]
p-Coumaric Acid[19]
p-tolylboronic acid[42]
pentane-1,5-diamine[44]
phenethylboronic acid[42]
phenoxyarsonous acid[16]
quinoline-8-sulfonamide[45]
sodium trithiocarbonate[23]
sulfanilamide derivative [46]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Carbonic anhydrase inhibitors: synthesis and inhibition against isozymes I, II and IV of topically acting antiglaucoma sulfonamides incorporating cis-5-norbornene-endo-3-carboxy-2-carboxamido moieties. J Enzyme Inhib. 2001;16(2):113-23. To Reference
Ref 2Immunohistochemical demonstration of the carbonic anhydrase isoenzymes I and II in pancreatic tumours. Histochem J. 1995 Feb;27(2):133-8. To Reference
Ref 3Physiology and molecular biology of renal carbonic anhydrase. J Nephrol. 2002 Mar-Apr;15 Suppl 5:S61-74. To Reference
Ref 4Nature of the inhibition of carbonic anhydrase by acetazolamide and benzthiazide. J Pharmacol Exp Ther. 1961 Mar;131:271-4. To Reference
Ref 5Diuretic activity of a dihydro-analog of benzthiazide; (3-benzylthiomethyl-6-chloro-7-sulfamyl-3,4 dihydro-1,2,4 benzothiadiazine, 1,1-dioxide). Chemotherapia (Basel). 1962;4:405-12. To Reference
Ref 6Localization of diuretic effects along the loop of Henle: an in vivo microperfusion study in rats. Clin Sci (Lond). 2000 Apr;98(4):481-8. To Reference
Ref 7Selective effect of thiazides on the human osteoblast-like cell line MG-63. Kidney Int. 1996 Nov;50(5):1476-82. To Reference
Ref 8Bioorg Med Chem. 2009 Jul 15;17(14):5054-8. Epub 2009 May 30.Carbonic anhydrase inhibitors. Inhibition studies of a coral secretory isoform by sulfonamides. To Reference
Ref 9Inhibition of carbonic anhydrases I and II by N-unsubstituted carbamate esters. J Biol Chem. 1992 Dec 15;267(35):25044-50. To Reference
Ref 10Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 11Bioorg Med Chem. 2009 Apr 15;17(8):3207-11. Epub 2009 Feb 4.Carbonic anhydrase inhibitors. Inhibition of human erythrocyte isozymes I and II with a series of antioxidant phenols. To Reference
Ref 12Bioorg Med Chem. 2008 Aug 1;16(15):7424-8. Epub 2008 Jun 13.Carbonic anhydrase inhibitors: inhibition of mammalian isoforms I-XIV with a series of substituted phenols including paracetamol and salicylic acid. To Reference
Ref 13Nucleic Acids Res. 2011 January; 39(Database issue): D1035CD1041. DrugBank 3.0: a comprehensive resource for Omics research on drugs To Reference
Ref 14Bioorg Med Chem Lett. 2005 Nov 1;15(21):4862-6.Carbonic anhydrase inhibitors: inhibition of the tumor-associated isozymes IX and XII with a library of aromatic and heteroaromatic sulfonamides. To Reference
Ref 15Bioorg Med Chem Lett. 2004 Dec 6;14(23):5775-80.Carbonic anhydrase inhibitors: synthesis and inhibition of cytosolic/tumor-associated carbonic anhydrase isozymes I, II, and IX with sulfonamides derived from 4-isothiocyanato-benzolamide. To Reference
Ref 16Bioorg Med Chem Lett. 2004 Nov 1;14(21):5435-9.Carbonic anhydrase inhibitors. Inhibition of the newly isolated murine isozyme XIII with anions. To Reference
Ref 17Bioorg Med Chem Lett. 2009 Dec 1;19(23):6649-54. Epub 2009 Oct 7.Carbonic anhydrase inhibitors. Characterization and inhibition studies of the most active beta-carbonic anhydrase from Mycobacterium tuberculosis, Rv3588c. To Reference
Ref 18Bioorg Med Chem Lett. 2010 Sep 1;20(17):5050-3. Epub 2010 Jul 13.Carbonic anhydrase inhibitors. Antioxidant polyphenols effectively inhibit mammalian isoforms I-XV. To Reference
Ref 19Bioorg Med Chem. 2010 Mar 15;18(6):2159-64. Epub 2010 Feb 6.Carbonic anhydrase inhibitors. Inhibition of mammalian isoforms I-XIV with a series of natural product polyphenols and phenolic acids. To Reference
Ref 20Bioorg Med Chem. 2007 Mar 15;15(6):2298-311. Epub 2007 Jan 19.Carbonic anhydrase and matrix metalloproteinase inhibitors. Inhibition of human tumor-associated isozymes IX and cytosolic isozyme I and II with sulfonylated hydroxamates. To Reference
Ref 21Bioorg Med Chem Lett. 2010 Dec 15;20(24):7255-8. Epub 2010 Oct 25.7,8-disubstituted- but not 6,7-disubstituted coumarins selectively inhibit the transmembrane, tumor-associated carbonic anhydrase isoforms IX and XII over the cytosolic ones I and II in the low nanomolar/subnanomolar range. To Reference
Ref 22Bioorg Med Chem Lett. 2008 Aug 1;18(15):4282-6. Epub 2008 Jul 5.Carbonic anhydrase inhibitors. Interaction of the antitumor sulfamate EMD 486019 with twelve mammalian carbonic anhydrase isoforms: Kinetic and X-ray crystallographic studies. To Reference
Ref 23Bioorg Med Chem Lett. 2009 Apr 1;19(7):1855-7. Epub 2009 Feb 26.Carbonic anhydrase inhibitors. Inhibition of cytosolic isoforms I, II, III, VII and XIII with less investigated inorganic anions. To Reference
Ref 24J Med Chem. 2010 Mar 11;53(5):2155-70.Highly potent first examples of dual aromatase-steroid sulfatase inhibitors based on a biphenyl template. To Reference
Ref 25J Med Chem. 2006 Dec 28;49(26):7683-96.2-substituted estradiol bis-sulfamates, multitargeted antitumor agents: synthesis, in vitro SAR, protein crystallography, and in vivo activity. To Reference
Ref 26Eur J Med Chem. 2010 Sep;45(9):3656-61. Epub 2010 May 12.Carbonic anhydrase inhibitors. Regioselective synthesis of novel 1-substituted 1,4-dihydro-4-oxo-3-pyridinesulfonamides and their inhibition of the human cytosolic isozymes I and II and transmembrane cancer-associated isozymes IX and XII. To Reference
Ref 27Bioorg Med Chem Lett. 2004 Dec 6;14(23):5781-6.Carbonic anhydrase inhibitors. Design of anticonvulsant sulfonamides incorporating indane moieties. To Reference
Ref 28J Med Chem. 2010 Apr 8;53(7):2913-26.Sulfonamide linked neoglycoconjugates--a new class of inhibitors for cancer-associated carbonic anhydrases. To Reference
Ref 29Bioorg Med Chem Lett. 2005 Mar 15;15(6):1683-6.Carbonic anhydrase inhibitors. Interaction of isozymes I, II, IV, V, and IX with organic phosphates and phosphonates. To Reference
Ref 30Bioorg Med Chem Lett. 2010 Jun 15;20(12):3601-5. Epub 2010 Apr 28.Carbonic anhydrase inhibitors: crystallographic and solution binding studies for the interaction of a boron-containing aromatic sulfamide with mammalian isoforms I-XV. To Reference
Ref 31Carbonic anhydrase inhibitors: inhibition of isozymes I, II and IV with N-hydroxysulfonamides--a novel class of intraocular pressure lowering agents. J Enzyme Inhib. 1998 Jul;13(4):267-84. To Reference
Ref 32J Med Chem. 2008 Jun 12;51(11):3051-6. Epub 2008 Mar 19.Recent developments of carbonic anhydrase inhibitors as potential anticancer drugs. To Reference
Ref 33Bioorg Med Chem Lett. 2010 Nov 1;20(21):6208-12. Epub 2010 Aug 26.Paraoxon, 4-nitrophenyl phosphate and acetate are substrates of - but not of -, - and -carbonic anhydrases. To Reference
Ref 34Bioorg Med Chem Lett. 2005 Dec 1;15(23):5192-6. Epub 2005 Oct 3.Carbonic anhydrase inhibitors: inhibition of the human isozymes I, II, VA, and IX with a library of substituted difluoromethanesulfonamides. To Reference
Ref 35J Med Chem. 2006 Jun 15;49(12):3496-500.Inhibition of carbonic anhydrase-II by sulfamate and sulfamide groups: an investigation involving direct thermodynamic binding measurements. To Reference
Ref 36Bioorg Med Chem Lett. 2009 Sep 1;19(17):4929-32. Epub 2009 Jul 22.Carbonic anhydrase inhibitors. Inhibition of the Rv1284 and Rv3273 beta-carbonic anhydrases from Mycobacterium tuberculosis with diazenylbenzenesulfonamides. To Reference
Ref 37Bioorg Med Chem. 2010 Aug 1;18(15):5498-503. Epub 2010 Jun 22.Mutation of Phe91 to Asn in human carbonic anhydrase I unexpectedly enhanced both catalytic activity and affinity for sulfonamide inhibitors. To Reference
Ref 38Eur J Med Chem. 2010 Mar;45(3):1225-9. Epub 2009 Dec 5.Synthesis and investigation of inhibition effect of fluorinated sulfonamide derivatives on carbonic anhydrase. To Reference
Ref 39Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. To Reference
Ref 40Sulfenamido-sulfonamides as inhibitors of carbonic anhydrase isozymes I, II and IV. J Enzyme Inhib. 1997 Aug;12(3):175-90. To Reference
Ref 41Bioorg Med Chem Lett. 2005 Sep 1;15(17):3821-7.Carbonic anhydrase inhibitors: design of thioureido sulfonamides with potent isozyme II and XII inhibitory properties and intraocular pressure lowering activity in a rabbit model of glaucoma. To Reference
Ref 42Bioorg Med Chem Lett. 2009 May 15;19(10):2642-5. Epub 2009 Apr 5.Carbonic anhydrase inhibitors. Inhibition of the fungal beta-carbonic anhydrases from Candida albicans and Cryptococcus neoformans with boronic acids. To Reference
Ref 43J Med Chem. 2009 Oct 8;52(19):5990-8.Carbonic anhydrase inhibitors. Comparison of aliphatic sulfamate/bis-sulfamate adducts with isozymes II and IX as a platform for designing tight-binding, more isoform-selective inhibitors. To Reference
Ref 44J Med Chem. 2010 Aug 12;53(15):5511-22.Polyamines inhibit carbonic anhydrases by anchoring to the zinc-coordinated water molecule. To Reference
Ref 45Bioorg Med Chem. 2009 Jan 15;17(2):553-7. Epub 2008 Dec 6.Ligand-based and structure-based virtual screening to identify carbonic anhydrase IX inhibitors. To Reference
Ref 46Bioorg Med Chem Lett. 2005 Jun 15;15(12):3096-101.Carbonic anhydrase inhibitors. Inhibition of cytosolic/tumor-associated carbonic anhydrase isozymes I, II, IX, and XII with Schiff's bases incorporating chromone and aromatic sulfonamide moieties, and their zinc complexes. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

 
   
           
 
Computer-aided Drug Design
About BIDD | Databases | Software | Teaching | Research |  Links

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543