Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
 

 

TTD Target ID: TTDS00411

Target Information
NameMacrophage colony-stimulating factor receptor    
Type of targetSuccessful target    
SynonymsCD115    
CSF-1-R    
CSF1R    
FMS    
Fms proto-oncogene    
c-fms    
DiseaseBone marrow transplant    [1]
Febrile neutropenia    [2]
Non-myeloid cancer    [2]
Drug(s)FilgrastimApprovedNeutropenia[3][4]
PegfilgrastimApprovedNon-myeloid cancer[4]
BioChemical ClassTransferases transferring phosphorus-containing groups    
PathwayCytokine-cytokine receptor interaction
Hematopoietic cell lineage
Jak-STAT signaling pathway
Pathways in cancer
UniProt IDP07333
Q99062
PDB Structure2I0V; 2I0Y; 2I1M; 2OGV; 3BEA; 3DPK; 1AZ7; 2D9Q.    
SequenceMGPGVLLLLLVATAWHGQGIPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTL YSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFED QDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSAL MGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHN NTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAY LNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANATTKDTY RHTFTLSLPRLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSVIWTFINGSGTLLCA ASGYPQPNVTWLQCSGHTDRCDEAQVLQVWDDPYPEVLSQEPFHKVTVQSLLTVETLEHN QTYECRAHNSVGSGSWAFIPISAGAHTHPPDEFLFTPVVVACMSIMALLLLLLLLLLYKY KQKPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEAT AFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVL VITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEGGVDYKNIHLEKKYVRRDSGFSSQGV DTYVEMRPVSTSSNDSFSEQDLDKEDGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVA ARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWS YGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHR PTFQQICSFLQEQAQEDRRERDYTNLPSSSRSGGSGSSSSELEEESSSEHLTCCEQGDIA QPLLQPNNYQFC
Target ValidationClick to Find Target Validation Information.    
InhibitorMLN-518[5]
N- (2-morpholinophenyl)-5-nitrofuran-2-carboxamide[6]
PKC-412[7]
BinderFilgrastim[3][4]
Pegfilgrastim[4]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Comparison between filgrastim and lenograstim plus chemotherapy for mobilization of PBPCs. Bone Marrow Transplant. 2009 Jul 6. [Epub ahead of print] To Reference
Ref 2Cost-effectiveness of pegfilgrastim versus six days of filgrastim for preventing febrile neutropenia in breast cancer patients. Tumori. 2009 Mar-Apr;95(2):219-26. To Reference
Ref 3XM02, the first granulocyte colony-stimulating factor biosimilar, is safe and effective in reducing the duration of severe neutropenia and incidence of febrile neutropenia in patients with non-Hodgkin lymphoma receiving chemotherapy. Leuk Lymphoma. 2009 Mar;50(3):374-9. To Reference
Ref 4Evidence that the granulocyte colony-stimulating factor (G-CSF) receptor plays a role in the pharmacokinetics of G-CSF and PegG-CSF using a G-CSF-R KO model. Pharmacol Res. 2004 Jul;50(1):55-8. To Reference
Ref 5J Med Chem. 2002 Aug 15;45(17):3772-93.Identification of orally active, potent, and selective 4-piperazinylquinazolines as antagonists of the platelet-derived growth factor receptor tyrosine kinase family. To Reference
Ref 6Bioorg Med Chem Lett. 2007 Nov 15;17(22):6070-4. Epub 2007 Sep 19.Potent 2'-aminoanilide inhibitors of cFMS as potential anti-inflammatory agents. To Reference
Ref 7Bioorg Med Chem. 2010 Mar 1;18(5):1789-97. Epub 2010 Jan 28.Colony stimulating factor-1 receptor as a target for small molecule inhibitors. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

 
   
           
 
Computer-aided Drug Design
About BIDD | Databases | Software | Teaching | Research |  Links

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543