Therapeutic Targets Database
BIDD Pharmainformatics Databases
 
   
 

 

TTD Target ID: TTDS00469

Target Information
NameNADH dehydrogenase    
Type of targetSuccessful target    
SynonymsMT-ND    
MTND    
NADH    
NADH-ubiquinone oxidoreductase    
ND    
DiseaseParkinson's disease    [1]
Drug(s)NADHApprovedParkinson's disease[1]
BioChemical ClassOxidoreductases acting on NADH or NADPH    
EC NumberEC 1.6.5.3
PathwayMetabolic pathways
Parkinson's disease
UniProt IDP03886
P03891
P03897
FunctionCore subunit of the mitochondrial membrane respiratory chain nadh dehydrogenase (complex i) that is believed to belong to the minimal assembly required for catalysis. Complex i functions in the transfer of electrons from nadh to the respiratory chain.    
SequenceMPMANLLLLIVPILIAMAFLMLTERKILGYMQLRKGPNVVGPYGLLQPFADAMKLFTKEP LKPATSTITLYITAPTLALTIALLLWTPLPMPNPLVNLNLGLLFILATSSLAVYSILWSG WASNSNYALIGALRAVAQTISYEVTLAIILLSTLLMSGSFNLSTLITTQEHLWLLLPSWP LAMMWFISTLAETNRTPFDLAEGESELVSGFNIEYAAGPFALFFMAEYTNIIMMNTLTTT IFLGTTYDALSPELYTTYFVTKTLLLTSLFLWIRTAYPRFRYDQLMHLLWKNFLPLTLAL LMWYVSMPITISSIPPQT
Target ValidationClick to Find Target Validation Information.    
Inhibitor6-Thiophen-2-yl-imidazo[2,1-b]thiazole[2]
6-Thiophen-3-yl-imidazo[2,1-b]thiazole[2]
N-Formylmethionine[3]
Riboflavin Monophosphate[4]
BinderNADH[1]
Cross References 3D Structure
Related Literature
On-Line Medical Dictionary
Ref 1Mechanism of cadmium-decreased glucuronidation in the rat. Biochem Pharmacol. 1992 Dec 1;44(11):2139-47. To Reference
Ref 2J Med Chem. 1995 Mar 31;38(7):1090-7.Thienylimidazo[2,1-b]thiazoles as inhibitors of mitochondrial NADH dehydrogenase. To Reference
Ref 3Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. To Reference
Ref 4Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. To Reference



 

Welcome to sign our Guestbook.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhu.


Dr. Chen Yuzong
Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

 
   
           
 
Computer-aided Drug Design
About BIDD | Databases | Software | Teaching | Research |  Links

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543